The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the Bromodomain of human SWI/SNF related matrix associated actin dependent regulator of cromatin subfamily A member 2. To be Published
    Site RSGI
    PDB Id 2dat Target Id hso002001973.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12993, Molecular Weight 12869.14 Da.
    Residues 110 Isoelectric Point 9.24
    Sequence spnppkltkqmnaiidtvinykdssgrqlsevfiqlpsrkelpeyyelirkpvdfkkikerirnhkyrs lgdlekdvmllchnaqtfnlegsqiyedsivlqsvfksarq
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch