The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RWD domain of human RWD omain containing protein 2. To be Published
    Site RSGI
    PDB Id 2daw Target Id hsi002012869.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12486, Molecular Weight 16120.87 Da.
    Residues 141 Isoelectric Point 5.17
    Sequence msasvkeslqlqllememlfsmfpnqgevkledvnaltnikrylegtrealppkiefvitlqieepkvk idlqvtmphsypylalqlfgrsseldrhqqlllnkgltsyigtfdpgelcvcaaiqwlqdnsasyflnr klv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch