.
The Open Protein Structure Annotation Network
PDB Keyword
.

2db0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH0542. To be Published
    Site RSGI
    PDB Id 2db0 Target Id pho001000542.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13832, Molecular Weight 28694.03 Da.
    Residues 253 Isoelectric Point 5.59
    Sequence msmeeeefdirealangehlekilimakydesvlkklielldddlwtvvknaisiimviaktredlyep mlkklfsllkkseaipltqeiakafgqmakekpelvksmipvlfanyrigdektkinvsyaleeiakan pmlmasivrdfmsmlssknredkltalnfieamgensfkyvnpflpriinllhdgdeivrasavealvh latlndklrkvvikrleelndtsslvnktvkegisrlllleghsss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.26801
    Matthews' coefficent 2.07 Rfactor 0.20501
    Waters 101 Solvent Content 40.50

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch