.
The Open Protein Structure Annotation Network
PDB Keyword
.

2db3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis for RNA unwinding by the DEAD-box protein Drosophila Vasa. Cell(Cambridge,Mass.) 125 287-300 2006
    Site RSGI
    PDB Id 2db3 Target Id trt001000262.1
    Molecular Characteristics
    Source Drosophila melanogaster
    Alias Ids TPS14127, Molecular Weight 47338.64 Da.
    Residues 424 Isoelectric Point 6.42
    Sequence efyippepsndaieifssgiasgihfskynnipvkvtgsdvpqpiqhftsadlrdiiidnvnksgykip tpiqkcsipvissgrdlmacaqtgsgktaafllpilsklledphelelgrpqvvivsptrelaiqifne arkfafesylkigivyggtsfrhqnecitrgchvviatpgrlldfvdrtfitfedtrfvvldeadrmld mgfsedmrrimthvtmrpehqtlmfsatfpeeiqrmageflknyvfvaigivggacsdvkqtiyevnky akrsklieilseqadgtivfvetkrgadflasflsekefpttsihgdrlqsqreqalrdfkngsmkvli atsvasrgldiknikhvinydmpskiddyvhrigrtgrvgnngratsffdpekdraiaadlvkilegsg qtvpdflrtc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.25
    Matthews' coefficent 3.12 Rfactor 0.197
    Waters 1319 Solvent Content 60.20

    Ligand Information
    Ligands ANP (PHOSPHOAMINOPHOSPHONIC) x 4
    Metals MG (MAGNESIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch