.
The Open Protein Structure Annotation Network
PDB Keyword
.

2db4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of rotor ring with DCCD of the V- ATPase from Enterococcus hirae. To be Published
    Site RSGI
    PDB Id 2db4 Target Id ar_001000494.2
    Molecular Characteristics
    Source Enterococcus hirae
    Alias Ids TPS12166, Molecular Weight 16036.11 Da.
    Residues 156 Isoelectric Point 6.53
    Sequence mmdylitqnggmvfavlamatatifsgigsakgvgmtgeaaaalttsqpekfgqalilqllpgtqglyg fviaflifinlgsdmsvvqglnflgaslpiaftglfsgiaqgkvaaagiqilakkpehatkgiifaamv etyailgfvisfllvlna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.40 Rfree 0.23094
    Matthews' coefficent 4.90 Rfactor 0.22499
    Waters 245 Solvent Content 74.89

    Ligand Information
    Ligands LHG (1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE) x 20;UMQ (UNDECYL-MALTOSIDE) x 10
    Metals NA (SODIUM) x 10

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch