.
The Open Protein Structure Annotation Network
PDB Keyword
.

2db7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of hypothetical protein MS0332. To be Published
    Site RSGI
    PDB Id 2db7 Target Id hsi002004800.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12374, Molecular Weight 6444.87 Da.
    Residues 57 Isoelectric Point 5.48
    Sequence gyfdahalamdyrslgfreclaevarylsiiegldasdplrvrlvshlnnyasqrea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.22
    Matthews' coefficent 2.09 Rfactor 0.192
    Waters 97 Solvent Content 41.07

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch