.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dba

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the tetratrico peptide repeat of human Smooth muscle cell associated protein-1, isoform 2. To be Published
    Site RSGI
    PDB Id 2dba Target Id hsi002005909.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12403, Molecular Weight 14679.73 Da.
    Residues 135 Isoelectric Point 6.13
    Sequence mtvsgpgtpeprpatpgassveqlrkegnelfkcgdyggalaaytqalgldatpqdqavlhrnraachl kledydkaeteaskaiekdggdvkalyrrsqaleklgrldqavldlqrcvslepknkvfqealrni
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch