.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dbi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Hypothetical Protein JW0805 from Escherichia coli. To be published
    Site RSGI
    PDB Id 2dbi Target Id eco002000805.1
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS12276, Molecular Weight 47326.98 Da.
    Residues 421 Isoelectric Point 5.56
    Sequence mastftsdtlpadhkaairqmkhalraqlgdvqqifnqlsddiatrvaeinalkaqgdavwpvlsyadi kaghvtaeqreqikrrgcavikghfpreqalgwdqsmldyldrnrfdevykgpgdnffgtlsasrpeiy piywsqaqmqarqseemanaqsflnrlwtfesdgkqwfnpdvsviypdrirrrppgttskglgahtdsg alerwllpayqrvfanvfngnlaqydpwhaahrteveeytvdnttkcsvfrtfqgwtalsdmlpgqgll hvvpipeamayvllrpllddvpedelcgvapgrvlpvseqwhplliealtsipkleagdsvwwhcdvih svapvenqqgwgnvmyipaapmceknlayahkvkaalekgaspgdfpredyetnwegrftladlnihgk ralgmdv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.216
    Matthews' coefficent 2.38 Rfactor 0.18
    Waters 617 Solvent Content 48.28

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch