The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein TTHC002 from Thermus thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2dbs Target Id ttk003002175.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14827, Molecular Weight 10003.16 Da.
    Residues 90 Isoelectric Point 4.44
    Sequence mvnpaerlaeldgvlmqylleadllrelpptyrlvllpldepevaaqalawameapnpegwpsvyalfl qgrpirllllgkevevapraa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2712
    Matthews' coefficent 2.11 Rfactor 0.2561
    Waters 19 Solvent Content 41.59

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch