.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dby

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the GTP-binding protein YchF in complexed with GDP. To be Published
    Site RSGI
    PDB Id 2dby Target Id ttk003001291.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14678, Molecular Weight 40508.14 Da.
    Residues 368 Isoelectric Point 5.43
    Sequence mlavgivglpnvgkstlfnaltranalaanypfatidknvgvvplederlyalqrtfakgervppvvpt hvefvdiaglvkgahkgeglgnqflahirevaaiahvlrcfpdpdvvhvmgrvdpledaevvetellla dlatlerrlerlrkearadrerlplleaaeglyvhlqegkpartfppseavarflketplltakpviyv anvaeedlpdgrgnpqveavrrkaleegaevvvvsarleaelaelsgeearellaayglqesglqrlar agyraldlltfftagekevrawtvrrgtkapraageihsdmergfiraevipwdklveaggwarakerg wvrlegkdyevqdgdviyvlfna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.221
    Matthews' coefficent 2.29 Rfactor 0.191
    Waters 359 Solvent Content 46.40

    Ligand Information
    Ligands GDP (GUANOSINE-5'-DIPHOSPHATE) x 1;FMT (FORMIC) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch