The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of amidase. To be Published
    Site RSGI
    PDB Id 2dc0 Target Id ttk003001378.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14709, Molecular Weight 46517.97 Da.
    Residues 434 Isoelectric Point 5.95
    Sequence mdlleakrlletgrttplalleealerakafqdrnalayldeeaarkealalteelrrgqvrgplhglp ltvkdlfpvkgmptragtkaplpplpeearavrrlreagallfaktnmheialgitgenpwtgpvrnav dpsrqaggssggsavavalgiglaslgtdtggsiripagfngvvgfkpsygrvslegalplsrstdhag pltrsvrdahflteilagesiplegvqnpvfgvpldflegrlgvevrkaftrlledlpalraevrevsl plegvyevytrlvryeaarihekalkehpegfspqvreallaglaltekdyrdavaerealrlelvkal rgvdalllpvqplpapplgteevelesgrkghreafitltlpfsllgvptlalpfakvegmpvglqvvg aygedgkvlalggwlearlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24
    Matthews' coefficent 2.77 Rfactor 0.22
    Waters 315 Solvent Content 55.65

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch