.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dc3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title High-resolution structure of human cytoglobin: identification of extra N- and C-termini and a new dimerization mode. Acta Crystallogr.,Sect.D 62 671-677 2006
    Site RSGI
    PDB Id 2dc3 Target Id my_001000023.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13692, Molecular Weight 21684.79 Da.
    Residues 193 Isoelectric Point 6.42
    Sequence gshmekvpgemeierrerseelseaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqfkhm edplemerspqlrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevv aeefasdfppetqrawaklrgliyshvtaaykevgwvqqvpnattppatlpssgp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.68 Rfree 0.181
    Matthews' coefficent 1.99 Rfactor 0.14
    Waters 265 Solvent Content 38.10

    Ligand Information
    Ligands HEM (PROTOPORPHYRIN) x 2;ACY (ACETIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch