The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PH1503 protein from Pyrococcus Horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2dcl Target Id pho001001503.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13993, Molecular Weight 14936.66 Da.
    Residues 130 Isoelectric Point 6.31
    Sequence mssmvevehwntlrlriyigendkwegrplykviveklremgiagatvyrgiygfgkksrvhssdvirl stdlpiivevvdrghniekvvnvikpmikdgmitveptivlwvgtqeeikkfeedaiaerq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.28 Rfree 0.29
    Matthews' coefficent 2.05 Rfactor 0.244
    Waters 123 Solvent Content 40.11

    Ligand Information
    Ligands AMP (ADENOSINE) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch