.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ddr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Basis of the Sphingomyelin Phosphodiesterase Activity in Neutral Sphingomyelinase from Bacillus cereus. J.Biol.Chem. 281 16157-16167 2006
    Site RSGI
    PDB Id 2ddr Target Id ar_001000745.1
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS12214, Molecular Weight 34306.38 Da.
    Residues 306 Isoelectric Point 5.56
    Sequence evsttqndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdnsasdrllgnlkk eypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcgpdnlsnkgfvytki kkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfiknknipnneyvliggdmnvnkinaennn dseyasmfktlnasvpsytghtatwdattnsiakynfpdspaeyldyiiaskdhanpsyienkvlqpks pqwtvtswfqkytyndysdhypveatismk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.40 Rfree 0.234
    Matthews' coefficent 2.18 Rfactor 0.213
    Waters 1323 Solvent Content 43.59

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 8

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch