.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ddz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Unknown Protein from Pyrococcus horikoshi. To be Published
    Site RSGI
    PDB Id 2ddz Target Id pho001000223.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13797, Molecular Weight 21642.07 Da.
    Residues 190 Isoelectric Point 6.12
    Sequence mnsmelliikerridydgsairshwayrnfgilgdslvvfrgkcnvkveemvdiedlrlrkeikgddmv hyilelfwhpdillasslqklliarlvellwnygieasrrgddiyvngrklsisiatvspvsikihigl nvktvgvppgvdaigleelgidptefmersakalveeiekvrkdslkvrwvt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.24 Rfree 0.247
    Matthews' coefficent 3.55 Rfactor 0.213
    Waters 401 Solvent Content 65.38

    Ligand Information
    Ligands GAI (GUANIDINE) x 8;GOL (GLYCEROL) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch