The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tt0972 protein from Thermus Thermophilus. To be Published
    Site RSGI
    PDB Id 2dev Target Id ttk003000972.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14502, Molecular Weight 7747.56 Da.
    Residues 69 Isoelectric Point 5.82
    Sequence mgkvykkvelvgtseegleaaiqaalararktlrhldwfevkeirgtigeagvkeyqvvlevgfrleet
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.45 Rfree 0.288
    Matthews' coefficent 2.37 Rfactor 0.246
    Waters 46 Solvent Content 48.14

    Ligand Information
    Metals CS (CESIUM) x 1;CL (CHLORIDE) x 2;NA (SODIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch