The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the PH0510 protein from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2df8 Target Id pho001000510.3
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13829, Molecular Weight 36811.82 Da.
    Residues 325 Isoelectric Point 6.27
    Sequence mktlieikqtpdgiikadkvfnkvkdkislpnrilylgcgsshflskllamvtnmhgglgialpcsefl ysketypigevelavgisrsgetteillalekinvkklgittressltrmcdyslvvpaieesvvmths ftsfyfaylqllrysyglpplnageiskateksleyeryireivesfdfqniiflgsgllypvaleasl kmkemsifwseayptfevrhgfkaiadektlvvlmveepfewheklvkefknqgakvlvisnspqdlgq dysielprlskdanpipylpivqllsyykavsrglnpdnprfldkvvrw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.191
    Matthews' coefficent 2.15 Rfactor 0.181
    Waters 785 Solvent Content 42.83

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch