The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from Thermus Thermophilus HB8. To be Published
    Site RSGI
    PDB Id 2dfu Target Id ttk003000360.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14347, Molecular Weight 29388.00 Da.
    Residues 264 Isoelectric Point 5.17
    Sequence mkilrfnegrwgvlegelvletdgpggnptgrrydlasvtllppatptkivcvgrnyrehiremghdfg edlpkepglflkgpnalarpgnprdpwgtaepvpypffteelhyegelavvvgdrmrhvppekaldhvl gytvavditardvqkkdlqwvraksadkflplgpwletdlnpqdtwvrtyvngtlrqeghtsqmifsva eilsyistfmtlepldvvltgtpegvgalrpgdrlevavegvgtlftligpkeerpw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.224
    Matthews' coefficent 3.31 Rfactor 0.197
    Waters 643 Solvent Content 62.87

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch