.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dgb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Thermus thermophilus PurS, One of the Subunits of Formylglycinamide Ribonucleotide Amidotransferase in the Purine Biosynthetic Pathway. To be published
    Site RSGI
    PDB Id 2dgb Target Id ttk003001807.2
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14796, Molecular Weight 9204.39 Da.
    Residues 84 Isoelectric Point 4.96
    Sequence mpryqatllielkkgildpqgravegvlkdlghpveevrvgkvleivfpaenlleaeekakamgallan pvmevyalealkelp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.244
    Matthews' coefficent 2.35 Rfactor 0.209
    Waters 168 Solvent Content 47.58

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch