The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA binding domain in Heterogeneous nuclear ribonucleoprotein Q. To be Published
    Site RSGI
    PDB Id 2dgu Target Id hsk003000744.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12827, Molecular Weight 10410.54 Da.
    Residues 90 Isoelectric Point 9.22
    Sequence makvkvlfvrnlantvteeilekafsqfgklervkklkdyafihfderdgavkameemngkdlegenie ivfakppdqkrkerkaqrqaa
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch