The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of the RRM Domain in the Human Poly (ADP-ribose) Polymerase Family, Member 10 Variant. To be Published
    Site RSGI
    PDB Id 2dhx Target Id hss001001894.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13282, Molecular Weight 9709.60 Da.
    Residues 91 Isoelectric Point 8.24
    Sequence gvavevrglppavpdelltlyfenrrrsgggpvlswqrlgcggvltfrepadaervlaqadhelhgaql slrpappraparlllqglppgt
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch