.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dip

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the ZZ domain of Zinc finger SWIM domain containing protein 2. To be Published
    Site RSGI
    PDB Id 2dip Target Id hsi002022572.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12550, Molecular Weight 10133.04 Da.
    Residues 85 Isoelectric Point 7.71
    Sequence leefknssklvaaaekerldkhlgipcnnckqfpiegkcykctecieyhlcqecfdsychlshtftfre krnqkwrslekradev
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch