.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dix

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the DSRM domain of Protein activator of the interferon-induced protein kinase. To be published
    Site RSGI
    PDB Id 2dix Target Id hss001000506.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13200, Molecular Weight 7840.66 Da.
    Residues 71 Isoelectric Point 9.07
    Sequence ktpiqvlheygmktknipvyecersdvqihvptftfrvtvgditctgegtskklakhraaeaainilka na
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch