.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dj8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of zf-MYND Domain of Protein CBFA2TI (Protein MTG8). To be published
    Site RSGI
    PDB Id 2dj8 Target Id hsi002005805.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12401, Molecular Weight 5405.62 Da.
    Residues 47 Isoelectric Point 6.43
    Sequence inqqedssescwncgrkasetcsgcntarycgsfcqhkdwekhhhic
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch