The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the first SH3 domain of mouse SH3 domain containing ring finger 2. To be Published
    Site RSGI
    PDB Id 2djq Target Id mmt008000996.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13639, Molecular Weight 6147.69 Da.
    Residues 55 Isoelectric Point 9.06
    Sequence prakalcnyrgknpgdlkfnkgdvillrrqldenwyqgeingvsgifpassvevi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch