.
The Open Protein Structure Annotation Network
PDB Keyword
.

2djs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structures of the fn3 domain of human ephrin type-B receptor 1. To be Published
    Site RSGI
    PDB Id 2djs Target Id hso002001071.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12951, Molecular Weight 10799.77 Da.
    Residues 95 Isoelectric Point 8.98
    Sequence pstvpimhqvsatmrsitlswpqpeqpngiildyeiryyekehnefnssmarsqtntaridglrpgmvy vvqvrartvagygkfsgkmcfqtltd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch