The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the stand-alone RAM-domain protein from Thermus thermophilus HB8. ACTA CRYSTALLOGR.,SECT.F 62 855-860 2006
    Site RSGI
    PDB Id 2djw Target Id ttk003001045.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14515, Molecular Weight 10112.11 Da.
    Residues 92 Isoelectric Point 4.68
    Sequence mitafvlirprgnrvqalgeaiaelpqvaevysvtgpydlvalvrlkdveelddvvtqgilslegvert etllafrayprrlldqgfalgqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.40 Rfree 0.29351
    Matthews' coefficent 3.12 Rfactor 0.24977
    Waters 224 Solvent Content 60.57

    Ligand Information
    Metals ZN (ZINC) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch