.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dk3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Mib-herc2 domain in HECT domain containing protein 1. To be Published
    Site RSGI
    PDB Id 2dk3 Target Id hsk002101105.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12756, Molecular Weight 8081.66 Da.
    Residues 73 Isoelectric Point 6.75
    Sequence vrsqvlkymvpgarvirgldwkwrdqdgspqgegtvtgelhngwidvtwdaggsnsyrmgaegkfdlkl apgy
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch