The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Splicing Factor Motif in Pre-mRNA splicing factor 18 (hPRP18). To be Published
    Site RSGI
    PDB Id 2dk4 Target Id hsi002003054.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12346, Molecular Weight 7382.07 Da.
    Residues 63 Isoelectric Point 5.43
    Sequence tssnpvlelelaeeklpmtlsrqevirrlrergepirlfgetdydafqrlrkieiltpevnkg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch