The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of Winged-Helix domain in RNA polymerase III 39KDa polypeptide. To be Published
    Site RSGI
    PDB Id 2dk5 Target Id hss001003795.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13343, Molecular Weight 8856.88 Da.
    Residues 78 Isoelectric Point 9.80
    Sequence dsqnagkmkgsdnqeklvyqiiedagnkgiwsrdvryksnlplteinkilknleskklikavksvaask kkvymlynl
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch