The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of rpc34 subunit in RNA polymerase III from mouse. To be Published
    Site RSGI
    PDB Id 2dk8 Target Id mmt007004751.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13477, Molecular Weight 7788.49 Da.
    Residues 68 Isoelectric Point 5.15
    Sequence pdadpveienriielchqfphgitdqviqnemphieaqqravainrllsmgqldllrsntgllyrikd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch