.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dkj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of T.th.HB8 Serine Hydroxymethyltransferase. To be Published
    Site RSGI
    PDB Id 2dkj Target Id ttk003000053.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14208, Molecular Weight 44616.86 Da.
    Residues 407 Isoelectric Point 6.45
    Sequence mvstlkrdealfelialeekrqregleliasenfvskqvreavgsvltnkyaegypgaryyggcevidr veslaierakalfgaawanvqphsgsqanmavymalmepgdtlmgmdlaagghlthgsrvnfsgklykv vsygvrpdtelidleevrrlalehrpkvivagasayprfwdfkafreiadevgaylvvdmahfaglvaa glhpnplpyahvvtstthktlrgprgglilsndpelgkridklifpgiqggplehviagkavaffealq pefkeysrlvvenakrlaeelarrgyrivtggtdnhlflvdlrpkgltgkeaeerldavgitvnknaip fdpkpprvtsgirigtpaittrgftpeemplvaelidrallegpsealreevrrlalahpmp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.15 Rfree 0.19
    Matthews' coefficent 2.53 Rfactor 0.18
    Waters 896 Solvent Content 51.33

    Ligand Information
    Ligands SO4 (SULFATE) x 2;PLP (PYRIDOXAL-5'-PHOSPHATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch