.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dl5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the first SH3 domain of human KIAA0769 protein. To be published
    Site RSGI
    PDB Id 2dl5 Target Id hsk002100751.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12731, Molecular Weight 7550.14 Da.
    Residues 65 Isoelectric Point 4.64
    Sequence tlrnypltckvvysykasqpdeltieehevleviedgdmedwvkarnkvgqvgyvpekylqfpts
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch