The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the fourth fn3 domain of human receptor-type tyrosine-protein phosphatase eta. To be Published
    Site RSGI
    PDB Id 2dle Target Id hso002002643.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13019, Molecular Weight 9748.40 Da.
    Residues 91 Isoelectric Point 4.74
    Sequence aiqvfdvtavnisatsltliwkvsdnesssnytykihvagetdssnlnvsepravipglrsstfynitv cpvlgdiegtpgflqvhtppvp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch