The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the SH3 domain of human KIAA1783 protein. To be published
    Site RSGI
    PDB Id 2dlp Target Id hsk002101752.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12781, Molecular Weight 7685.24 Da.
    Residues 72 Isoelectric Point 6.49
    Sequence sgyvialrsyitdncsllsfhrgdlikllpvatlepgwqfgsaggrsglfpadivqpaaapdfsfskeq rsg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch