The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the tandem four zf-C2H2 domain repeats of murine GLI-Kruppel family member HKR3. To be published
    Site RSGI
    PDB Id 2dlq Target Id mmi002017035.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13398, Molecular Weight 13363.01 Da.
    Residues 111 Isoelectric Point 9.25
    Sequence vecptchkkflskyylkvhnrkhtgekpfecpkcgkcyfrkenllehearncmnrseqvftcsvcqetf rrrmelrlhmvshtgempykcsscsqqfmqkkdlqshmiklh
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch