.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dm6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of anti-configuration of indomethacin and leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complex reveals the structural basis of broad spectrum indomethacin efficacy. J.Biochem.(Tokyo) 140 457-466 2006
    Site RSGI
    PDB Id 2dm6 Target Id my_001000011.4
    Molecular Characteristics
    Source Cavia porcellus
    Alias Ids TPS13674, Molecular Weight 36188.15 Da.
    Residues 333 Isoelectric Point 8.47
    Sequence spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlkegavmmg qqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklplslalgtigmpgltayfgll evcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsdekiaylkqigfdaafnyktvnsleeal kkaspdgydcyfdnvggeflntvlsqmkdfgkiaicgaisvynrmdqlppgpspesiiykqlriegfiv yrwqgdvrekalrdlmkwvlegkiqyhehvtkgfenmpaafiemlnganlgkavvta
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.224
    Matthews' coefficent 2.38 Rfactor 0.181
    Waters 600 Solvent Content 48.22

    Ligand Information
    Ligands NAP (NADP) x 2;IMN (INDOMETHACIN) x 1;TAM (TRIS(HYDROXYETHYL)AMINOMETHANE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch