.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dm8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the eighth PDZ domain of human InaD-like protein. To be published
    Site RSGI
    PDB Id 2dm8 Target Id hso003006830.5
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13100, Molecular Weight 11290.09 Da.
    Residues 103 Isoelectric Point 5.02
    Sequence patcpivpgqemiieiskgrsglglsivggkdtplnaivihevyeegaaardgrlwagdqilevngvdl rnssheeaitalrqtpqkvrlvvyrdeahyrdee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch