The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PH1978 from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2dm9 Target Id pho001001978.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS14025, Molecular Weight 22887.01 Da.
    Residues 198 Isoelectric Point 5.29
    Sequence mngaeliiqeinkeaerkieyilnearqqaekikeearrnaeakaewiirraktqaelekqriianarl evrrkrlaiqeeiissvleevkrrletmsedeyfesvkallkeaikelnekkvrvmsnektlgliasri eeikselgdvsielgetvdtmggvivetedgriridntfearmerfegeirstiakvlfg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.259
    Matthews' coefficent 1.60 Rfactor 0.219
    Waters 166 Solvent Content 28.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch