.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dmd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the N-terminal C2H2 type zinc-binding domain of the Zinc finger protein 64, isoforms 1 and 2. To be Published
    Site RSGI
    PDB Id 2dmd Target Id hss001003730.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS13337, Molecular Weight 9477.38 Da.
    Residues 83 Isoelectric Point 9.37
    Sequence phkcevcgkcfsrkdklkthmrchtgvkpykcktcdyaaadssslnkhlrihsderpfkcqicpyasrn ssqltvhlrshtgd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch