The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the TFIIS domain II of human PHD finger protein 3. To be Published
    Site RSGI
    PDB Id 2dme Target Id hsk002200238.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12789, Molecular Weight 12590.02 Da.
    Residues 107 Isoelectric Point 9.99
    Sequence sadqirqsvrhslkdilmkrltdsnlkvpeekaakvatkiekelfsffrdtdakyknkyrslmfnlkdp knnilfkkvlkgevtpdhlirmspeelaskelaawrrr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch