.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dml

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the first thioredoxin domain of mouse Protein disulfide-isomerase A6. To be Published
    Site RSGI
    PDB Id 2dml Target Id mmt008001233.1
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS13647, Molecular Weight 12668.58 Da.
    Residues 117 Isoelectric Point 6.11
    Sequence avsglysssddvieltpsnfnreviqsdglwlvefyapwcghcqrltpewkkaatalkdvvkvgavnad khqslggqygvqgfptikifganknkpedyqggrtgeaivdaalsalr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch