.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dmm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The solution structure of the second thioredoxin domain of human Protein disulfide-isomerase A3. To be Published
    Site RSGI
    PDB Id 2dmm Target Id hsi002014276.1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12510, Molecular Weight 14685.84 Da.
    Residues 129 Isoelectric Point 5.27
    Sequence fdgnlkrylksepipesndgpvkvvvaenfdeivnnenkdvliefyapwcghcknlepkykelgeklsk dpniviakmdatandvpspyevrgfptiyfspankklnpkkyeggrelsdfisylqreat
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch