The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the second RNA binding domain of RNA binding motif protein 23. To be Published
    Site RSGI
    PDB Id 2dnz Target Id hsi002012635.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12480, Molecular Weight 9153.90 Da.
    Residues 82 Isoelectric Point 5.59
    Sequence lyvgslhfnitedmlrgifepfgkidnivlmkdsdtgrskgygfitfsdsecarraleqlngfelagrp mrvghvterldgg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch