The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the RNA binding domain of squamous cell carcinoma antigen recognized by T cells 3. To be Published
    Site RSGI
    PDB Id 2do4 Target Id hsk002000153.2
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS12574, Molecular Weight 9764.81 Da.
    Residues 87 Isoelectric Point 8.60
    Sequence vfrystslekhklfisglpfsctkeeleeickahgtvkdlrlvtnragkpkglayveyenesqasqavm kmdgmtikeniikvaisn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch