The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural characterization of the ribosome maturation protein, RimM. J.Bacteriol. 189 6397-6406 2007
    Site RSGI
    PDB Id 2dog Target Id ttk003000786.3
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14435, Molecular Weight 9480.50 Da.
    Residues 85 Isoelectric Point 5.58
    Sequence mrlveigrfgapyalkgglrfrgepvvlhlervyveghgwraiedlyrvgeelvvhlagvtdrtlaeal vglrvyaevadlpple
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch