.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dp6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Family 5 Uracil-DNA Glycosylase Bound to DNA Reveals Insights into the Mechanism for Substrate Recognition and Catalysis. To be Published
    Site RSGI
    PDB Id 2dp6 Target Id ttk003000722.4
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14421, Molecular Weight 24284.75 Da.
    Residues 219 Isoelectric Point 9.72
    Sequence mdreafvqtltacrlcprlvawreevvgrkrafrgepywarpvpgfgdpearillfglapgahgsnrtg rpftgdasgaflypllheaglsskpeslpgddlrlygvyltaavrcappknkptpeelracarwtevel gllpevrvyvalgrialeallahfglrksahpfrhgahyplpggrhllasyhvsrqntqtgrltremfl evlmeakrlagl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.217
    Matthews' coefficent 3.57 Rfactor 0.204
    Waters 210 Solvent Content 65.52

    Ligand Information
    Ligands 2HP (DIHYDROGENPHOSPHATE) x 2;SF4 (IRON/SULFUR) x 1;GOL (GLYCEROL) x 2;EOH (ETHANOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch