The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the GMP synthase from Pyrococcus horikoshii OT3. To be Published
    Site RSGI
    PDB Id 2dpl Target Id pho001001347.1
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS13990, Molecular Weight 34560.13 Da.
    Residues 308 Isoelectric Point 5.91
    Sequence mdwgrfveekvreiretvgdskaiialsggvdsstaavlahkaigdrlhavfvntgflrkgepefvvkt frdefgmnlhyvdaqdrffsalkgvtdpeekrkiigrvfievfeevakkigaeyliqgtiapdwiesqg kikshhnvgglpeklnlklieplrdlykdevrelakflglpekiynrmpfpgpglavrvigevtpekir ivreanaiveeeveraglrpwqafavllgvktvgvqgdirayketiavrivesidgmtanamnvpwevl qriafritseipevgrvlyditnkppatiefe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.43 Rfree 0.249
    Matthews' coefficent 2.38 Rfactor 0.236
    Waters 952 Solvent Content 48.26

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch