The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Rabbit L-Gulonate 3-Dehydrogenase. To be Published
    Site RSGI
    PDB Id 2dpo Target Id my_001000051.1
    Molecular Characteristics
    Source Oryctolagus cuniculus
    Alias Ids TPS13733, Molecular Weight 35270.89 Da.
    Residues 320 Isoelectric Point 6.67
    Sequence maspaagdvlivgsglvgrswamlfasggfrvklydieprqitgalenirkemkslqqsgslkgslsae eqlslissctnlaeavegvvhiqecvpenldlkrkifaqldsivddrvvlssssscllpsklftglahv kqcivahpvnppyyiplvelvphpetspatvdrthalmrkigqspvrvlkeidgfvlnrlqyaiiseaw rlveegivspsdldlvmsdglgmryafigpletmhlnaegmlsysdrysegmkrvlksfgsipefsgat vekvnqamckkgpadpehlaarrewrdeclkrelaklkrqmqpq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.206
    Matthews' coefficent 2.25 Rfactor 0.182
    Waters 419 Solvent Content 45.40

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch