.
The Open Protein Structure Annotation Network
PDB Keyword
.

2dpw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical Transferase from Thermus thermophilus. To be Published
    Site RSGI
    PDB Id 2dpw Target Id ttk003001858.1
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS14807, Molecular Weight 25360.24 Da.
    Residues 232 Isoelectric Point 9.18
    Sequence mrpsaivlaggkeawaerfgvgskalvpyrgrpmvewvlealyaaglspvyvgenpglvpapaltlpdr ggllenleqalehvegrvlvatgdiphlteeavrfvldkapeaalvypivpkeavearfprtkrtyarl regtftggnlllldkslfrkalplarrvvalrkrplalarlvgwdvllklllgrlslaevearaqrilg vearalvtpypevgvdvdreedlvs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.90 Rfree 0.281
    Matthews' coefficent 3.24 Rfactor 0.226
    Waters 30 Solvent Content 61.98

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch